Arnaques

Service d'aide
 


Menu du service




Dernier témoignage
Arnaque 20959
Date: 12/12/2017 à 12h01

Je tiens à signaler une arnaque par mail en voilà le contenu : Bonsoir, j'ai vu votre profil sur pôle emploi et je ...



Arnaques sur Internet
Liste d'arnaques présentes sur le web

Le site Arnaques-Internet.info a été développé pour aider les internautes à signaler en ligne les arnaques rencontrés lors de leur navigation sur Internet : en répertoriant ici les arnaques, ces dernières apparaissent dans les résultats des moteurs de recherche et renseignent ainsi les visiteurs à partir d'un e-mail, d'un nom, d'un texte, d'une adresse ip ou encore d'un numéro de téléphone.
 
Si vous avez été victime d'une arnaque via un site Internet ou que vous en connaissez une qui n'est pas présente sur ce site, ayez le réflexe : signaler une arnaque en ligne.
 
Information complémentaire : pour les personnes victimes d'arnaque depuis la Côte d'Ivoire, voici l'adresse e-mail du service qui s'occupe des arnaques de ce pays : cybercrime (arrobase) interieur.gouv.ci
 

CLAIRE.BELGRADE@GMAIL.COM CLAIRE BELGRADE 10.223.111.130 : ARNAQUE PAYPAL ?

Arnaque signalée
Type d'arnaque Type d'arnaqueArnaque Paypal
E-mail arnaque Adresse e-mailclaire.belgrade@gmail.com
Pseudonyme arnaque Pseudonyme ou nom d'emprunt utiliséclaire belgrade *
Numéro de téléphone d'une arnaque Numéro de téléphone
Site web arnaque Site web
IP arnaque Adresse IP10.223.111.130
Texte d'une arnaque Contenu de l'arnaque
Return-Path:

Received: from mwinf5c80 (mwinf5c80.me-wanadoo.net [10.223.111.130])
by mwinb1q02 with LMTPA;
Tue, 10 Jan 2017 21:16:58 +0100

X-Sieve: CMU Sieve 2.3

Received: from mail-io0-f178.google.com ([209.85.223.178])
by mwinf5c80 with ME
id WkEK1u00m3rZRp501kGywQ; Tue, 10 Jan 2017 21:16:58 +0100

X-bcc: olivierbel62@orange.fr

X-ME-bounce-domain: orange.fr

X-ME-engine: default

X-me-spamcause: (0)(0000)gggruggvucftvghtrhhoucdtuddrfeelgedrvdeigddufeehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlo
hhuthemucegtddtnecunecujfgurhepjghfhfffkffuvfgtgfesthhqredttddtjeenucfhrhhomhepvehlrghirhgvuceuvghlghhrrgguvgcuoegtlhgrihhrvgdrsgg
vlhhgrhgruggvsehgmhgrihhlrdgtohhmqeenucfkphepvddtledrkeehrddvvdefrddujeeknecurfgrrhgrmhephhgvlhhopehmrghilhdqihhotddqfhdujeekrdhgo
hhoghhlvgdrtghomhdpihhnvghtpedvtdelrdekhedrvddvfedrudejkedpmhgrihhlfhhrohhmpegtlhgrihhrvgdrsggvlhhgrhgruggvsehgmhgrihhlrdgtohhmpdh
rtghpthhtohepohhlihhvihgvrhgsvghliedvsehorhgrnhhgvgdrfhhr

X-me-spamlevel: not-spam

X-ME-Helo: mail-io0-f178.google.com

X-ME-IP: 209.85.223.178

X-ME-Entity: ofr

Received: by mail-io0-f178.google.com with SMTP id j18so67278550ioe.2
for ; Tue, 10 Jan 2017 12:16:58 -0800 (PST)

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20161025;
h=mime-version:in-reply-to:references:from:date:message-id:subject:to
:content-transfer-encoding;
bh=7i2lcXFYTt9NhsrhRysDgBJNXYIxsvYijH8x4mrpLr0=;
b=mxybvcVu04hGdLGkMVxOOcvYy1HDKDBQOcZlX8lh7rvASVzq7FvtY3SjD2FdOgOml2
C+NU9x3LedkcricRUqpur7umHREJO4klYMyUzO2q0p47Kc/SEaKipfzBPAu/dPNuCcW5
XjkpelhAtyCV2vbeH80v6sv87aXUNnhSo4ZBr/JtdYnIdwcObXHRyUJpSEWwnP1nOFfP
VvH4mtUp4ly4DdJqrwy+dJ9CRcVna5VKdCWPRe5iBS53+uTFmL7AfqGPAYh5xvA6bvO9
58mcoMMBj4JC9GC8+eIgpTjWJsh/Km9R3WQ0l3vCcjSeinFcqRXhzk4xJG1M0QGVfvRP
oSfw==

X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:mime-version:in-reply-to:references:from:date
:message-id:subject:to:content-transfer-encoding;
bh=7i2lcXFYTt9NhsrhRysDgBJNXYIxsvYijH8x4mrpLr0=;
b=bXGOXkaj+DVO7Y4KjJDsp0iSPx37Zgb38ZFDV2xc4fD1yQgs+AupXhPQSNfBTv3/OW
vZLXk1LIkv5r5z+iLhyZO8354V06njb42eXprlsSjmxFH1VQzeF6REfoXLdDVDbyRExh
5zeTyB1ed0Pbd16OUfUKChlYQPOj88l64Xt+CZQmBdV1Ps43bq1tlePt7qKYw+cUy2LM
FD9sQSHl+r1CMIT+RiOYf9XOhLLFvpVKTePfzl5e1HVWF81GrtSzWEN1gP7vZhn32jI+
jpy2OLiIYosyltNUBC7wDqhAlAjC+L6yxCripWeieiXxoUMea6J/rgLLNkbCoamDhcNO
uXtw==

X-Gm-Message-State: AIkVDXIcanUdxq24MwvACERk0rgXIcQrRgweoax8CJDa1/pIWpiN/oAu0I77M+vNBBhqoJcc1Vi21gXvHac0tg==

X-Received: by 10.107.175.221 with SMTP id p90mr5658565ioo.80.1484079417667;
Tue, 10 Jan 2017 12:16:57 -0800 (PST)

MIME-Version: 1.0

Received: by 10.64.126.8 with HTTP; Tue, 10 Jan 2017 12:16:57 -0800 (PST)

In-Reply-To: <58754009.00005B.05860@PA077557>

References:


<1458124871.25554.1484071787519.JavaMail.www@wwinf1g21>
<58754009.00005B.05860@PA077557>

From: Claire Belgrade

Date: Tue, 10 Jan 2017 21:16:57 +0100

Message-ID:

Subject: =?UTF-8?Q?Re=3A_Re=3A_RE_=3A_Re=3A_RE_=3A_Re=3A_Re=3A_RE_=3A_Re=3A_RE_=3A_Re=3A_RE_=3A?=
=?UTF-8?Q?_=22Claire_B=22_a_r=C3=A9pondu_=C3=A0_votre_annonce_=22Anne_roumanoff_LILL?=
=?UTF-8?Q?E_26=2F01=2F17_a_20h30=22_sur_Leboncoin=2Efr?=

To: "olivierbel62@orange.fr"

Content-Type: text/plain; charset=UTF-8

Content-Transfer-Encoding: quoted-printable
Information arnaque Remarques de la personne ayant signalé l'arnaquej'espere qu'avec cette adress IP , vous allez l'arreter.

Merci
Date arnaque Date du signalement
Statistique arnaque Statistiques de la page
Mise en ligne le 10/01/2017
239 personnes ont consulté cette page, merci pour votre signalement !
Fichier arnaque Document(s)
Partage arnaque On compte sur vous !
 
Partager sur les
réseaux sociaux
afin de lutter contre
la fraude sur Internet...
Service

Signaler une arnaque Signaler une arnaque récente en ligne : signaler une arnaque Internet ou signaler une arnaque Téléphonique.
Attention aux arnaques sur Internet !

* : Généralement un nom d'emprunt. Tout référence à une personne existante possédant le même nom est totalement fortuite.
Ce signalement a été effectué par un Internaute, si vous n'êtes pas de son avis et que vous souhaitez contester ce signalement, vous pouvez remplir le formulaire de suppression prévu à cet effet (voir en bas de page).



Avis Ajouter votre témoignage sur cette page :

Alerte Les propos injurieux (insultes) sont interdits, merci !
Lien Les adresses URL sont interdites, merci !
 
Pseudonyme prenom Votre prénom :
Uniquement votre prénom.
N'indiquez pas votre nom de famille, merci !
 
E-mail Votre adresse e-mail (non visible) :
 

Validation Merci de recopier le code ci-dessus (anti-spam) :

 


Merci de ne cliquer qu'une fois sur le bouton ci-dessous
afin d'éviter les doublons !

Liste de commentaires et d'avis :

Attention Avertissement : Méfiez-vous des faux témoignages !
 
Des arnaqueurs laissent régulièrement des commentaires sur ce site de se faire passer pour des officiers de police, des lieutenants, des gendarmes, etc.
Le but étant d'essayer d'arnaquer des personnes ayant déjà été arnaquées.
Nous essayons de filtrer au maximum les commentaires frauduleux mais certains peuvent passer au travers, soyez prudent !
 
Un policier n'aura jamais une adresse e-mail professionnelle qui se termine par @gmail.com ou @hotmail.com ou tout autre messagerie gratuite !
Porter plainteSi vous souhaitez porter plainte, rendez-vous dans un comissariat. Ne contacter personne par e-mail ! Police
 
Autres arnaques populaires dans les commentaires :
Crédit : Ne souscrivez jamais un prêt auprès d'un inconnu.
Argent : Méfiez vous des propositions trop alléchantes !
Grand gagnant : on ne gagne pas au loto sans y avoir participé.
Aide professionnelle : attention aux faux avocats, huissiers, juges, etc.
 
Ne vous fiez pas aux apparences ! Méfiez-vous !  



Liste d'arnaques par type : Arnaque Leboncoin - Arnaque Paypal - Arnaque par mail (Hotmail) - Arnaque ebay - Arnaque aux sentiments - Arnaque emploi - Arnaque Western union - Arnaque immobilier
Plus de 15 000 arnaques sur Internet et 20 000 arnaques téléphoniques ont été signalés sur Arnaques-Internet.info
supprimer Pour supprimer une page de ce site Internet, cliquez ici
Ayez le réflexe : dès que vous êtes confronté à une arnaque : signaler une arnaque sur Internet
 
Mentions légales